PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G0013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 250aa    MW: 29380.9 Da    PI: 10.0225
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G0013genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171862146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg W + Ed++l+d+v+++G+++W++Ia++++ gR++k+c++rw++
      Gh_D11G0013 18 RGHWRPAEDDKLLDLVQRYGPHNWNAIAEKLQ-GRSGKSCRLRWFS 62
                     899*****************************.***********86 PP

2Myb_DNA-binding55.99.8e-1870113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Gh_D11G0013  70 RSPFTEEEEERLLASHRIHGNR-WSVIARLFP-GRTDNAVKNHWHV 113
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5251364IPR017930Myb domain
SMARTSM007173.8E-141766IPR001005SANT/Myb domain
SuperFamilySSF466897.49E-2918111IPR009057Homeodomain-like
PfamPF002493.1E-171863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-261971IPR009057Homeodomain-like
CDDcd001671.72E-132160No hitNo description
PROSITE profilePS5129425.11765119IPR017930Myb domain
SMARTSM007172.4E-1569117IPR001005SANT/Myb domain
PfamPF002492.0E-1470112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2072118IPR009057Homeodomain-like
CDDcd001671.70E-1272112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGKAYLRFFI ANQQMCSRGH WRPAEDDKLL DLVQRYGPHN WNAIAEKLQG RSGKSCRLRW  60
FSQLDPRINR SPFTEEEEER LLASHRIHGN RWSVIARLFP GRTDNAVKNH WHVIMARRCR  120
RQRSSSKTLP PSTSTSTSHQ HHITSTTLFP HNNYMHAFPP YSYFKHFYAH NPNPSLTTTT  180
QAIADTTQPT EFYDFLQVNT DSNESEVTDN TCKRDGEEVD QEHQSRPAVP FFDFLSVPRK  240
LYTIHKRRLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-33151191105C-Myb DNA-Binding Domain
1msf_C5e-33151191105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6149471e-69JX614947.1 Gossypium hirsutum clone NBRI_GE58686 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488370.11e-162PREDICTED: transcriptional activator Myb-like isoform X1
TrEMBLA0A0D2QIV71e-173A0A0D2QIV7_G
STRINGVIT_17s0000g01890.t013e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.16e-79myb domain protein 52